服務熱線
400-021-2200

現貨供應,歡迎訂購: :
Trefoil Factor-1 Human Recombinant
5ug/20ug/1mg
| Catalogue Number | CYT-586 | |||||
| Synonyms | TFF-1, TFF1, pS2, BCEI, HPS, HP1.A, pNR-2, D21S21, pS2 protein, Trefoil factor 1, Breast cancer estrogen-inducible protein. | |||||
| Introduction | The Trefoil Factor peptides (TFF1, TFF2 and TFF3) are stable secretory proteins expressed in the gastrointestinal tract (gastric mucosa), and are involved in intestinal mucosal defense and repair. TFF1 is an essential protein for normal differentiation of the antral and pyloric gastric mucosa and functions as a gastric-specific tumor suppressor gene. TFF1 is a stabilizer of the mucous gel overlying the gastrointestinal mucosa that provides a physical barrier against various noxious agents. TFF1 protects the mucosa from isults, stabilizes the mucus layer, & affects healing of the epithelium. TFF1 is commonly expressed in tumors. TFF1 is related with the cell membrane of MCF-7 cells. High levels of TFF1 and TFF2 are found in serum from inflammatory bowel disease. | |||||
| Description | TFF-1 Human Recombinant produced in E.Coli is a homodimer, non-glycosylated, polypeptide chain containing 2 x 60 amino acids which includes a 40 amino acid trefoil motif containing 3 conserved interamolecular disulfide bonds and having a total molecular mass of 13.2 kDa. TFF-1 Human Recombinant is purified by proprietary chromatographic techniques. | |||||
| Source | Escherichia Coli. | |||||
| Physical Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. | |||||
| Formulation | The protein was lyophilized after dialysis against 1xPBS pH-7.4. | |||||
| Solubility | It is recommended to reconstitute the lyophilized TFF1 in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions. | |||||
| Stability | Lyophilized TFF1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution TFF1 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. | |||||
| Purity | Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. | |||||
| Amino acid sequence | EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFY PNTIDVPPEEECEF. | |||||
| Biological Activity | Determined by its ability to activate ERK1/2 (a MAPkinase signaling molecule) using a concentration 1,000-2,000ng/ml corresponding to a specific activity of 500-1,000IU/mg. | |||||
| Usage | ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals. | |||||
| Related Products |
|
Related Products
Activin A cyt-569 Hystemcell.cn Recombinant Human Activin-A
Activin A Plant-Active cyt-414 Hystemcell.cn Recombinant Human Activin-A Active
Activin A HEK-Active cyt-078 Hystemcell.cn Recombinant Human Activin-A HEK-Active
Activin A Plant cyt-052 Hystemcell.cn Recombinant Human Activin-A, Plant
Activin B Active cyt-057 Hystemcell.cn Recombinant Human Activin-B Active
Activin B cyt-058 Hystemcell.cn Recombinant Human Activin-B
Activin A, Active cyt-145 Hystemcell.cn Recombinant Human Activin-A, Active
mActivin A cyt-146 Hystemcell.cn Recombinant Mouse Activin-A
rActivin A cyt-147 Hystemcell.cn Recombinant Rat Activin-A
Acrp30 cyt-024 Human Adiponectin
Acrp30 cyt-280 Hystemcell.cn Recombinant Human Adiponectin
Acrp30 His cyt-433 Hystemcell.cn Recombinant Human Adiponectin, His tag
mAcrp30 His cyt-537 Hystemcell.cn Recombinant Mouse Adiponectin, His tag
Acrp30 HEK cyt-434 Hystemcell.cn Recombinant Human Adiponectin glycosilated, HEK
mAcrp30 HEK cyt-435 Hystemcell.cn Recombinant Mouse Adiponectin glycosilated, HEK
pAcrp30 HEK cyt-696 Hystemcell.cn Recombinant Porcine Adiponectin glycosilated, HEK
Acrp30 Tri cyt-233 Hystemcell.cn Recombinant Human Adiponectin Trimeric Form
mAcrp30 Tri cyt-247 Hystemcell.cn Recombinant Mouse Adiponectin Trimeric Form
gAcrp30 cyt-615 Hystemcell.cn Recombinant Human Adiponectin Globular
gAcrp30 His cyt-277 Hystemcell.cn Recombinant Human Adiponectin Globular, His tag
mgAcrp30 cyt-432 Hystemcell.cn Recombinant Mouse Adiponectin Globular
AIF1 cyt-697 Hystemcell.cn Recombinant Human Allograft Inflammatory Factor 1
AIF1L cyt-007 Hystemcell.cn Recombinant Human Allograft Inflammatory Factor 1 Like
AITRL cyt-076 Hystemcell.cn Recombinant Human AITRL
AITRL His cyt-317 Hystemcell.cn Recombinant Human AITRL, His Tag
ANGPT1 cyt-074 Hystemcell.cn Recombinant Human Angiopoietin-1
ANGPTL3 cyt-248 Hystemcell.cn Recombinant Human Angiopoietin-like Protein 3
ANGPTL4 cyt-249 Hystemcell.cn Recombinant Human Angiopoietin-like Protein 4
ANGPTL4 HEK cyt-698 Hystemcell.cn Recombinant Human Angiopoietin-like Protein 4, HEK
APOA1 cyt-661 Hystemcell.cn Recombinant Human Apolipoprotein A-I
APOA1 cyt-037 Human Apolipoprotein A-I
APOA2 cyt-038 Human Apolipoprotein A-II
APOA5 cyt-025 Hystemcell.cn Recombinant Human Apolipoprotein A-V
AREG cyt-041 Hystemcell.cn Recombinant Human Amphiregulin
Clusterin cyt-278 Hystemcell.cn Recombinant Human Apoliprotein-J
Clusterin cyt-548 Human Apoliprotein-J
rClusterin cyt-437 Hystemcell.cn Recombinant Rat Apoliprotein-J
k9Clusterin cyt-549 Hystemcell.cn Recombinant Canine Apoliprotein-J
k9Clusterin HEK cyt-618 Hystemcell.cn Recombinant Canine Apoliprotein-J HEK
APO D cyt-547 Hystemcell.cn Recombinant Human Apoliprotein-D
APO D GST cyt-652 Hystemcell.cn Recombinant Human APO-D GST Tag
APOH cyt-189 Hystemcell.cn Recombinant Human Apoliprotein-H
APOM cyt-715 Hystemcell.cn Recombinant Human Apolipoprotein-M
APOM HEK cyt-026 Hystemcell.cn Recombinant Human Apolipoprotein-M, HEK
Artemin cyt-306 Hystemcell.cn Recombinant Human Artemin
BD 1 cyt-564 Hystemcell.cn Recombinant Human Beta Defensin -1
mBD 1 cyt-044 Hystemcell.cn Recombinant Mouse Beta Defensin -1
rBD 1 cyt-062 Hystemcell.cn Recombinant Rat Beta Defensin -1
BD 2 cyt-571 Hystemcell.cn Recombinant Human Beta Defensin -2
mBD 2 cyt-035 Hystemcell.cn Recombinant Mouse Beta Defensin -2
BD 3 cyt-461 Hystemcell.cn Recombinant Human Beta Defensin -3
mBD 3 cyt-036 Hystemcell.cn Recombinant Mouse Beta Defensin -3
rBD 3 cyt-063 Hystemcell.cn Recombinant Rat Beta Defensin -3
BD 4 cyt-599 Hystemcell.cn Recombinant Human Beta Defensin -4
rBD 4 cyt-066 Hystemcell.cn Recombinant Rat Beta Defensin -4
BDNF cyt-207 Hystemcell.cn Recombinant Human Brain-Derived Neurotrophic Factor
proBDNF cyt-014 Hystemcell.cn Recombinant Human Precursor Brain-Derived Neurotrophic Factor
BAFF cyt-307 Hystemcell.cn Recombinant Human BAFF (BLyS)
BAFF His cyt-545 Hystemcell.cn Recombinant Human BAFF (BLyS), His Tag
BAFF Plant cyt-054 Hystemcell.cn Recombinant Human BAFF (BLyS), Plant
BAFF R cyt-429 Hystemcell.cn Recombinant Human BAFF (BLyS) Receptor
BMPR1A cyt-380 Hystemcell.cn Recombinant Human Bone Morphogenetic protein Receptor-1A
BMPR1A HEK cyt-713 Hystemcell.cn Recombinant Human Bone Morphogenetic protein Receptor-1A HEK
BMP 2 cyt-261 Hystemcell.cn Recombinant Human Bone Morphogenetic protein-2
BMP 2 HEK cyt-080 Hystemcell.cn Recombinant Human Bone Morphogenetic protein-2, HEK
BMP 2 Mono cyt-627 Hystemcell.cn Recombinant Human Bone Morphogenetic protein-2 Monomer
Pro BMP 2 cyt-427 Hystemcell.cn Recombinant Human Pro Bone Morphogenetic protein-2
BMP 4 cyt-361 Hystemcell.cn Recombinant Human Bone Morphogenetic protein-4
BMP 4 Active cyt-081 Hystemcell.cn Recombinant Human Bone Morphogenetic protein-4 Active
BMP 5 cyt-660 Hystemcell.cn Recombinant Human Bone Morphogenetic protein-5
BMP 7 cyt-333 Hystemcell.cn Recombinant Human Bone Morphogenetic protein-7
BMP 7 His cyt-629 Hystemcell.cn Recombinant Human Bone Morphogenetic protein-7 His Tag
BMP 7 CHO cyt-276 Hystemcell.cn Recombinant Human Bone Morphogenetic protein-7, CHO
BMP 7 Plant cyt-039 Hystemcell.cn Recombinant Human Bone Morphogenetic protein-7, Plant
BMP 7 HEK cyt-082 Hystemcell.cn Recombinant Human Bone Morphogenetic protein-7, HEK
b NGF cyt-579 Hystemcell.cn Recombinant Human beta Nerve Growth Factor
b NGF CHO cyt-246 Hystemcell.cn Recombinant Human beta Nerve Growth Factor, CHO
b NGF HEK cyt-079 Hystemcell.cn Recombinant Human beta Nerve Growth Factor, HEK
mb NGF cyt-581 Hystemcell.cn Recombinant Mouse beta Nerve Growth Factor
mb NGF cyt-440 Mouse beta Nerve Growth Factor
ProNGF cyt-426 Hystemcell.cn Recombinant Human Pro-Nerve Growth Factor
BNP cyt-327 Hystemcell.cn Recombinant Human B-type Natriuretic Protein
BNP His cyt-605 Hystemcell.cn Recombinant Human B-type Natriuretic Protein His Tag
BNP cyt-369 Human B-type Natriuretic Protein
BST2 cyt-059 Hystemcell.cn Recombinant Human Bone Marrow Stromal Cell Antigen 2
BTC cyt-330 Hystemcell.cn Recombinant Human Betacellulin
BTC His cyt-077 Hystemcell.cn Recombinant Human Betacellulin, His Tag
mBTC cyt-131 Hystemcell.cn Recombinant Mouse Betacellulin
bBTC cyt-406 Hystemcell.cn Recombinant Bovine Betacellulin
CDNF cyt-167 Hystemcell.cn Recombinant Human Cerebral Dopamine Neurotrophic Factor
mCDNF cyt-729 Hystemcell.cn Recombinant Mouse Cerebral Dopamine Neurotrophic Factor
rCDNF cyt-730 Hystemcell.cn Recombinant Rat Cerebral Dopamine Neurotrophic Factor
CLCF1 cyt-071 Hystemcell.cn Recombinant Human Cardiotrophin-Like Cytokine Factor 1
CNTF cyt-272 Hystemcell.cn Recombinant Human Ciliary Neurotrophic Factor
CNTF His cyt-573 Hystemcell.cn Recombinant Human Ciliary Neurotrophic Factor, His Tag
mCNTF cyt-139 Hystemcell.cn Recombinant Mouse Ciliary Neurotrophic Factor
rCNTF cyt-654 Hystemcell.cn Recombinant Rat Ciliary Neurotrophic Factor
CT 1 cyt-436 Hystemcell.cn Recombinant Human Cardiotrophin-1
mCT 1 cyt-151 Hystemcell.cn Recombinant Mouse Cardiotrophin-1
rCT 1 cyt-199 Hystemcell.cn Recombinant Rat Cardiotrophin-1
CTGF cyt-541 Hystemcell.cn Recombinant Human Connective Tissue Growth Factor
CTGF His cyt-438 Hystemcell.cn Recombinant Human Connective Tissue Growth Factor, His Tag
CTGF (182-250 a.a.) cyt-526 Hystemcell.cn Recombinant Human Connective Tissue Growth Factor 182-250 a.a.
CTGF HEK cyt-687 Hystemcell.cn Recombinant Human Connective Tissue Growth Factor, HEK
CTLA 4 cyt-366 Hystemcell.cn Recombinant Human Cytotoxic T-Lymphocyte Associated Antigen-4
CYR61 cyt-164 Hystemcell.cn Recombinant Human Cysteine-Rich Angiogenic Inducer 61
EBI3 cyt-367 Hystemcell.cn Recombinant Human Epstein Barr Virus Induced 3
EBI3 His cyt-668 Hystemcell.cn Recombinant Human Epstein Barr Virus Induced 3, His Tag
mEBI3 cyt-621 Hystemcell.cn Recombinant Mouse Epstein Barr Virus Induced 3
EG VEGF cyt-338 Hystemcell.cn Recombinant Human Endocrine Gland Vacular Endothelial Growth Factor
EGF cyt-217 Hystemcell.cn Recombinant Human Epidermal Growth Factor
EGF Pichia cyt-332 Hystemcell.cn Recombinant Human Epidermal Growth Factor, Pichia
EGF (Leu 21) cyt-466 Hystemcell.cn Recombinant Human Epidermal Growth Factor 21-Leu
mEGF cyt-326 Hystemcell.cn Recombinant Mouse Epidermal Growth Factor
mEGF cyt-554 Mouse Epidermal Growth Factor
mEGF, His cyt-138 Hystemcell.cn Recombinant Mouse Epidermal Growth Factor, His
rEGF cyt-556 Rat Epidermal Growth Factor
rEGF cyt-669 Hystemcell.cn Recombinant Rat Epidermal Growth Factor
EMAP II cyt-607 Hystemcell.cn Recombinant Human Endothelial-Monocyte Activating Polypeptide II
AIMP1 cyt-021 Hystemcell.cn Recombinant Human Aminoacyl tRNA Synthetase Complex-Interacting Multifunctional Protein 1
Endoglin Sf9 cyt-389 Hystemcell.cn Recombinant Human Endoglin, Sf9
Endoglin cyt-525 Hystemcell.cn Recombinant Human Endoglin
mEndoglin cyt-424 Hystemcell.cn Recombinant Mouse Endoglin
EPGN cyt-601 Hystemcell.cn Recombinant Human Epigen
EREG cyt-609 Hystemcell.cn Recombinant Human Epiregulin
EPO a cyt-201 Hystemcell.cn Recombinant Human Erythropoietin-alpha
EPO a Fc cyt-325 Hystemcell.cn Recombinant Human Erythropoietin-alpha Fc/Chimera
EPO a HEK cyt-083 Hystemcell.cn Recombinant Human Erythropoietin-alpha, HEK
FAS cyt-125 Hystemcell.cn Recombinant Human sFas Receptor
FASLG cyt-031 Hystemcell.cn Recombinant Human FAS Ligand
FASLG HEK cyt-051 Hystemcell.cn Recombinant Human FAS Ligand, HEK
FGF 1 cyt-264 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-acidic
FGF 1 Sf9 cyt-364 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-acidic, Sf9
mFGF 1 cyt-528 Hystemcell.cn Recombinant Mouse Fibroblast Growth Factor-acidic
mFGF 1 His cyt-072 Hystemcell.cn Recombinant Mouse Fibroblast Growth Factor-acidic, His Tag
rFGF 1 cyt-075 Hystemcell.cn Recombinant Rat Fibroblast Growth Factor-acidic
baFGF cyt-613 Bovine Fibroblast Growth Factor-acidic
FGF 2 cyt-218 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-basic
FGF 2 Sf9 cyt-365 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-basic, Sf9
FGF 2 (147 a.a.) cyt-557 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-basic (147 a.a)
FGF 2 293 Cells cyt-085 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-basic, 293 Cells
FGF2 Plant cyt-123 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-basic, Plant
bFGF 2 cyt-288 Hystemcell.cn Recombinant Bovine Fibroblast Growth Factor-basic
bFGF 2 cyt-560 Bovine Fibroblast Growth Factor-basic
mFGF 2 cyt-386 Hystemcell.cn Recombinant Mouse Fibroblast Growth Factor-basic
rFGF 2 cyt-608 Hystemcell.cn Recombinant Rat Fibroblast Growth Factor-basic
FGF 4 cyt-312 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-4
FGF 4 HEK cyt-084 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-4, HEK
FGF 8 cyt-714 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-8
mFGF 8 cyt-070 Hystemcell.cn Recombinant Mouse Fibroblast Growth Factor-8
FGF 8 HEK cyt-087 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-8, HEK
FGF 9 cyt-415 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-9
mFGF 9 cyt-349 Hystemcell.cn Recombinant Mouse Fibroblast Growth Factor-9
rFGF 9 cyt-558 Hystemcell.cn Recombinant Rat Fibroblast Growth Factor-9
FGF12 cyt-620 Hystemcell.cn Recombinant Human Fibroblast Growth Factor 12
FGF13 cyt-121 Hystemcell.cn Recombinant Human Fibroblast Growth Factor 13
mFGF-15 cyt-027 Hystemcell.cn Recombinant Mouse Fibroblast Growth Factor-15
FGF-18 cyt-120 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-18
mFGF-18 cyt-064 Hystemcell.cn Recombinant Mouse Fibroblast Growth Factor-18
rFGF-18 cyt-176 Hystemcell.cn Recombinant Rat Fibroblast Growth Factor-18
FGF 19 cyt-700 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-19
FGF 19 His cyt-279 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-19 His Tag
FGF 21 cyt-474 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-21
FGF 21 His cyt-281 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-21, His Tag
mFGF 21 cyt-339 Hystemcell.cn Recombinant Mouse Fibroblast Growth Factor-21
mFGF 21 His cyt-516 Hystemcell.cn Recombinant Mouse Fibroblast Growth Factor-21, His Tag
rFGF 21 cyt-130 Hystemcell.cn Recombinant Rat Fibroblast Growth Factor-21
bFGF 21 cyt-657 Hystemcell.cn Recombinant Bovine Fibroblast Growth Factor-21
FGF 22 cyt-428 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-22
FGF 23 cyt-020 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-23
FGF 23 His cyt-374 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-23 His Tag
FGF 23 C-term cyt-028 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-23 C-Terminal
Flt3 Ligand cyt-331 Hystemcell.cn Recombinant Human Flt3-Ligand
Flt3 Ligand HEK cyt-706 Hystemcell.cn Recombinant Human Flt3-Ligand, HEK
Flt3 Ligand Sf9 cyt-409 Hystemcell.cn Recombinant Human Flt3-Ligand, Sf9
mFlt3 Ligand cyt-340 Hystemcell.cn Recombinant Mouse Flt3-Ligand
rmFlt3 Ligand cyt-157 Hystemcell.cn Recombinant Rhesus Macaque Flt3-Ligand
FST cyt-232 Hystemcell.cn Recombinant Human Follistatin
FST His cyt-029 Hystemcell.cn Recombinant Human Follistatin His Tag
mFST cyt-124 Hystemcell.cn Recombinant Mouse Follistatin
HB-EGF cyt-119 Hystemcell.cn Recombinant Human Proheparin-Binding EGF-like Growth Factor
mHB-EGF cyt-068 Hystemcell.cn Recombinant Mouse Proheparin-Binding EGF-like Growth Factor
rHB-EGF cyt-170 Hystemcell.cn Recombinant Rat Proheparin-Binding EGF-like Growth Factor
LGALS1 cyt-544 Hystemcell.cn Recombinant Human Galectin-1
mLGALS1 cyt-186 Hystemcell.cn Recombinant Mouse Galectin-1
LGALS2 cyt-725 Hystemcell.cn Recombinant Human Galectin-2
mLGALS2 cyt-019 Hystemcell.cn Recombinant Mouse Galectin-2
LGALS3 cyt-606 Hystemcell.cn Recombinant Human Galectin-3
LGALS3 His cyt-693 Hystemcell.cn Recombinant Human Galectin-3 His Tag
mLGALS3 cyt-188 Hystemcell.cn Recombinant Mouse Galectin-3
LGALS4 cyt-686 Hystemcell.cn Recombinant Human Galectin-4
mLGALS4 cyt-187 Hystemcell.cn Recombinant Mouse Galectin-4
LGALS7 cyt-016 Hystemcell.cn Recombinant Human Galectin-7
LGALS7 His cyt-617 Hystemcell.cn Recombinant Human Galectin-7 His Tag
mLGALS7 cyt-184 Hystemcell.cn Recombinant Mouse Galectin-7
LGALS8 cyt-017 Hystemcell.cn Recombinant Human Galectin-8
LGALS8 His cyt-727 Hystemcell.cn Recombinant Human Galectin-8, His Tag
mLGALS8 cyt-185 Hystemcell.cn Recombinant Mouse Galectin-8
LGALS9 cyt-708 Hystemcell.cn Recombinant Human Galectin-9
mLGALS9 cyt-550 Hystemcell.cn Recombinant Mouse Galectin-9
LGALS13 cyt-004 Hystemcell.cn Recombinant Human Galectin-13
LGALS14 cyt-003 Hystemcell.cn Recombinant Human Galectin-14
LGALSL cyt-073 Hystemcell.cn Recombinant Human Galectin-Related Protein
GDNF cyt-305 Hystemcell.cn Recombinant Human Glial-Derived Neurotrophic Factor
GDF3 cyt-694 Hystemcell.cn Recombinant Human Growth and Differentiation factor 3
GDF5 cyt-442 Hystemcell.cn Recombinant Human Growth and Differentiation factor 5
GDF5 His cyt-653 Hystemcell.cn Recombinant Human Growth and Differentiation factor 5 His Tag
GDF10 cyt-659 Hystemcell.cn Recombinant Human Growth and Differentiation factor 10
GDF15 His cyt-691 Hystemcell.cn Recombinant Human Growth and Differentiation factor 15, His Tag
GDF15 D cyt-314 Hystemcell.cn Recombinant Human Growth and Differentiation factor 15 D-Vairant
GDF15 cyt-335 Hystemcell.cn Recombinant Human Growth and Differentiation factor 15
G CSF cyt-220 Hystemcell.cn Recombinant Human Granulocyte-Colony Stimulating Factor
G CSF His cyt-476 Hystemcell.cn Recombinant Human Granulocyte-Colony Stimulating Factor, His Tag
G CSF CHO cyt-329 Hystemcell.cn Recombinant Human Granulocyte-Colony Stimulating Factor, CHO
G CSF PEG cyt-018 Hystemcell.cn Recombinant Human Pegylated Granulocyte-Colony Stimulating Factor
G CSF HEK cyt-088 Hystemcell.cn Recombinant Human Granulocyte-Colony Stimulating Factor, HEK
mG CSF cyt-410 Hystemcell.cn Recombinant Mouse Granulocyte-Colony Stimulating Factor
GH cyt-202 Hystemcell.cn Recombinant Human Growth Hormone
pGH 22kDa cyt-235 Hystemcell.cn Recombinant Human Placental Corr Growth Hormone
GH 20kDa cyt-259 Hystemcell.cn Recombinant Human Pituitary Growth Hormone 20kDa
pGH 20kDa cyt-337 Hystemcell.cn Recombinant Human Placental Growth Hormone 20kDa
GH Plant cyt-053 Hystemcell.cn Recombinant Human Growth Hormone, Plant
GH HEK cyt-091 Hystemcell.cn Recombinant Human Growth Hormone, HEK
GHBP cyt-238 Hystemcell.cn Recombinant Human Growth Hormone Binding Protein
oGHBP cyt-470 Hystemcell.cn Recombinant Ovine Growth Hormone Binding Protein
bGHBP cyt-471 Hystemcell.cn Recombinant Bovine Growth Hormone Binding Protein
raGHBP cyt-593 Hystemcell.cn Recombinant Rabbit Growth Hormone Binding Protein
chGH cyt-430 Hystemcell.cn Recombinant Chicken Growth Hormone
oGH cyt-237 Hystemcell.cn Recombinant Ovine Growth Hormone
oGH Placental cyt-594 Hystemcell.cn Recombinant Placental Ovine Growth Hormone
bGH cyt-636 Hystemcell.cn Recombinant Bovine Growth Hormone
mGH cyt-540 Hystemcell.cn Recombinant Mouse Growth Hormone
rGH cyt-296 Hystemcell.cn Recombinant Rat Growth Hormone
cGH cyt-297 Hystemcell.cn Recombinant Carp Growth Hormone
dGH cyt-498 Hystemcell.cn Recombinant Denis Growth Hormone
maiGH cyt-499 Hystemcell.cn Recombinant Mai Mai Growth Hormone
sGH cyt-529 Hystemcell.cn Recombinant Gilthead Seabream Growth Hormone
raGH cyt-514 Hystemcell.cn Recombinant Rabbit Growth Hormone
pGH cyt-519 Hystemcell.cn Recombinant Porcine Growth Hormone
chGH Antagonist cyt-538 Hystemcell.cn Recombinant Chicken Growth Hormone Anatagonist
oGH Antagonist cyt-215 Hystemcell.cn Recombinant Ovine Growth Hormone Anatagonist
zGH cyt-710 Hystemcell.cn Recombinant Zebrafish Growth Hormone
zGH Mutant cyt-709 Hystemcell.cn Recombinant Zebrafish Growth Hormone Mutant
GM CSF cyt-221 Hystemcell.cn Recombinant Human Granulocyte Macrophage-Colony Stimulating Factor
GM CSF Pichia cyt-324 Hystemcell.cn Recombinant Human Granulocyte Macrophage-Colony Stimulating Factor, Pichia
GM CSF Sf9 cyt-416 Hystemcell.cn Recombinant Human Granulocyte Macrophage-Colony Stimulating Factor, Sf9
GM CSF HEK cyt-089 Hystemcell.cn Recombinant Human Granulocyte Macrophage-Colony Stimulating Factor, HEK
GM CSF His cyt-477 Hystemcell.cn Recombinant Human Granulocyte Macrophage-Colony Stimulating Factor, His Tag
PIXY321 cyt-360 Hystemcell.cn Recombinant Human gm-csf/IL-3 Fusion Protein (PIXY321)
mGM CSF cyt-222 Hystemcell.cn Recombinant Mouse Granulocyte Macrophage-Colony Stimulating Factor
rGM CSF cyt-395 Hystemcell.cn Recombinant Rat Granulocyte Macrophage-Colony Stimulating Factor
pGM CSF cyt-401 Hystemcell.cn Recombinant Porcine Granulocyte Macrophage-Colony Stimulating Factor
rmGM CSF cyt-720 Hystemcell.cn Recombinant Rhesus Macaque Granulocyte Macrophage-Colony Stimulating Factor
k9GM CSF cyt-724 Hystemcell.cn Recombinant Canine Granulocyte Macrophage-Colony Stimulating Factor
GMF b cyt-565 Hystemcell.cn Recombinant Human Glia Maturation Factor Beta
GMF b His cyt-726 Hystemcell.cn Recombinant Human Glia Maturation Factor Beta His Tag
mGMF b cyt-006 Hystemcell.cn Recombinant Mouse Glia Maturation Factor Beta
rGMF b cyt-049 Hystemcell.cn Recombinant Rat Glia Maturation Factor Beta
GMFG cyt-632 Hystemcell.cn Recombinant Human Glia Maturation Factor Gamma
HDGF cyt-681 Hystemcell.cn Recombinant Human Hepatoma-Derived Growth Factor
HDGF2 cyt-132 Hystemcell.cn Recombinant Human Hepatoma-Derived Growth Factor-2
HGF CHO cyt-251 Hystemcell.cn Recombinant Human Hepatocyte Growth Factor, CHO
HGF Sf9 cyt-244 Hystemcell.cn Recombinant Human Hepatocyte Growth Factor, Sf9
HGF HEK cyt-090 Hystemcell.cn Recombinant Human Hepatocyte Growth Factor, HEK
HGF-A cyt-664 Hystemcell.cn Recombinant Human Hepatocyte Growth Factor A Chain
HGF-B cyt-665 Hystemcell.cn Recombinant Human Hepatocyte Growth Factor B Chain
pHGF cyt-522 Porcine Hepatocyte Promoting Growth Factor
IFI30 cyt-183 Hystemcell.cn Recombinant Human Interferon Gamma-Inducible protein 30
IFN a 1 cyt-291 Hystemcell.cn Recombinant Human Interferon-alpha 1
IFN a 1a cyt-520 Hystemcell.cn Recombinant Human Interferon-alpha 1a
IFN a 1b cyt-283 Hystemcell.cn Recombinant Human Interferon-alpha 1b
IFN a 2a cyt-204 Hystemcell.cn Recombinant Human Interferon-alpha 2a
IFN a 2a Plant cyt-543 Hystemcell.cn Recombinant Human Interferon-alpha 2a, Tobacco
IFN a 2b cyt-205 Hystemcell.cn Recombinant Human Interferon-alpha 2b
IFN a 2b Yeast cyt-460 Hystemcell.cn Recombinant Human Interferon-alpha 2b, Saccharomyces
IFN a 2b 20kd-PEG cyt-034 Hystemcell.cn Recombinant Human Interferon-alpha 2b 20kd-Pegylated
IFN a 2b HEK cyt-092 Hystemcell.cn Recombinant Human Interferon-alpha 2b, HEK
IFN a 2a HEK cyt-093 Hystemcell.cn Recombinant Human Interferon-alpha 2a, HEK
IFNA7 cyt-196 Hystemcell.cn Recombinant Human Interferon-alpha 7
IFNA14 cyt-135 Hystemcell.cn Recombinant Human Interferon-alpha 14
IFN b 1a cyt-236 Hystemcell.cn Recombinant Human Interferon-beta 1a
IFN b 1b cyt-234 Hystemcell.cn Recombinant Human Interferon-beta 1b
mIFN b His cyt-651 Hystemcell.cn Recombinant Mouse Interferon-beta His Tag
IFN g cyt-206 Hystemcell.cn Recombinant Human Interferon-gamma
IFN g His cyt-478 Hystemcell.cn Recombinant Human Interferon-gamma His Tag
mIFN g cyt-358 Hystemcell.cn Recombinant Mouse Interferon-gamma
rIFN g cyt-359 Hystemcell.cn Recombinant Rat Interferon-gamma
pIFN g cyt-402 Hystemcell.cn Recombinant Porcine Interferon-gamma
qIFN g cyt-739 Hystemcell.cn Recombinant Equine Interferon-gamma
IFNW1 cyt-040 Hystemcell.cn Recombinant Human Interferon-Omega 1
oIFN tau cyt-377 Hystemcell.cn Recombinant Ovine Interferon-Tau
IRF 1 cyt-449 Hystemcell.cn Recombinant Human Interferon Regulatory Factor-1
IRF 2 cyt-534 Hystemcell.cn Recombinant Human Interferon Regulatory Factor-2
IRF 3 cyt-292 Hystemcell.cn Recombinant Human Interferon Regulatory Factor-3
IGF1 cyt-216 Hystemcell.cn Recombinant Human Insulin Like Growth Factor-1
IGF1 GST cyt-690 Hystemcell.cn Recombinant Human Insulin Like Growth Factor-1, GST-Tag
IGF1 Des1-3 cyt-518 Hystemcell.cn Recombinant Human Insulin Like Growth Factor-1 Des (1-3)
Long R3 IGF1 cyt-022 Hystemcell.cn Recombinant Human LR3 Insulin Like Growth Factor-1
IGF1 N15 cyt-128 Hystemcell.cn Recombinant Human Insulin Like Growth Factor-1 N15 Labeled
mIGF1 cyt-229 Hystemcell.cn Recombinant Mouse Insulin Like Growth Factor-1
rIGF1 cyt-289 Hystemcell.cn Recombinant Rat Insulin Like Growth Factor-1
sIGF1 cyt-295 Hystemcell.cn Recombinant Gilthead Seabream Insulin Like Growth Factor-1
IGF2 cyt-265 Hystemcell.cn Recombinant Human Insulin Like Growth Factor-2
pro-IGF2 cyt-110 Hystemcell.cn Recombinant Human Pro-Insulin Like Growth Factor-2
IGFBP 1 cyt-299 Human Insulin Like Growth Factor Binding Protein-1
IGFBP 3 cyt-300 Hystemcell.cn Recombinant Human Insulin Like Growth Factor Binding Protein-3
IGFBP 4 cyt-030 Hystemcell.cn Recombinant Human Insulin Like Growth Factor Binding Protein-4
IGFBP 5 cyt-464 Hystemcell.cn Recombinant Human Insulin Like Growth Factor Binding Protein-5
IGFBP 6 cyt-258 Hystemcell.cn Recombinant Human Insulin Like Growth Factor Binding Protein-6
IHH cyt-195 Hystemcell.cn Recombinant Human Indian Hedgehog
IL 1 alpha cyt-253 Hystemcell.cn Recombinant Human Interleukin-1 alpha
IL 1 alpha His cyt-479 Hystemcell.cn Recombinant Human Interleukin-1 alpha, His Tag
mIL 1 alpha cyt-523 Hystemcell.cn Recombinant Mouse Interleukin-1 alpha
rIL 1 alpha cyt-381 Hystemcell.cn Recombinant Rat Interleukin-1 alpha
pIL 1 alpha cyt-396 Hystemcell.cn Recombinant Porcine Interleukin-1 alpha
IL 1 beta cyt-208 Hystemcell.cn Recombinant Human Interleukin-1 beta
IL 1 beta His cyt-480 Hystemcell.cn Recombinant Human Interleukin-1 beta, His Tag
IL 1 beta HEK cyt-094 Hystemcell.cn Recombinant Human Interleukin-1 beta, HEK
mIL 1 beta cyt-273 Hystemcell.cn Recombinant Mouse Interleukin-1 beta
mIL 1 beta His cyt-578 Hystemcell.cn Recombinant Mouse Interleukin-1 beta, His Tag
rIL 1 beta cyt-394 Hystemcell.cn Recombinant Rat Interleukin-1 beta
pIL 1 beta cyt-400 Hystemcell.cn Recombinant Porcine Interleukin-1 beta
rmIL 1 beta cyt-718 Hystemcell.cn Recombinant Rhesus Macaque Interleukin-1 beta
IL 1RA cyt-203 Hystemcell.cn Recombinant Human Interleukin-1 Receptor Antagonist
IL 1RA His cyt-481 Hystemcell.cn Recombinant Human Interleukin-1 Receptor Antagonist, His Tag
IL1RL1 cyt-671 Hystemcell.cn Recombinant Human Interleukin-1 Receptor Like-1
mIL 1RA cyt-658 Hystemcell.cn Recombinant Mouse Interleukin-1 Receptor Antagonist
mIL 1RA His cyt-136 Hystemcell.cn Recombinant Mouse Interleukin-1 Receptor Antagonist, His Tag
rIL 1RA cyt-152 Hystemcell.cn Recombinant Rat Interleukin-1 Receptor Antagonist
hIL 1RA cyt-010 Hystemcell.cn Recombinant Horse Interleukin-1 Receptor Antagonist
IL 2 cyt-209 Hystemcell.cn Recombinant Human Interleukin-2
IL 2 His cyt-666 Hystemcell.cn Recombinant Human Interleukin-2 His Tag
IL 2 HEK cyt-095 Hystemcell.cn Recombinant Human Interleukin 2, HEK
mIL 2 cyt-370 Hystemcell.cn Recombinant Mouse Interleukin-2
mIL 2 His cyt-624 Hystemcell.cn Recombinant Mouse Interleukin-2, His Tag
rIL 2 cyt-382 Hystemcell.cn Recombinant Rat Interleukin-2
pIL 2 cyt-397 Hystemcell.cn Recombinant Porcine Interleukin-2
qIL2 cyt-738 Hystemcell.cn Recombinant Equine Interleukin-2
sIL 2R cyt-285 Hystemcell.cn Recombinant Human Soluble Iinterleukin-2 Receptor alpha
IL 3 cyt-210 Hystemcell.cn Recombinant Human Interleukin-3
IL 3 His cyt-482 Hystemcell.cn Recombinant Human Interleukin-3, His Tag
IL 3 HEK cyt-096 Hystemcell.cn Recombinant Human Interleukin 3, HEK
mIL 3 cyt-371 Hystemcell.cn Recombinant Mouse Interleukin-3
rIL 3 cyt-383 Hystemcell.cn Recombinant Rat Interleukin-3
IL 3 Sf9 cyt-417 Hystemcell.cn Recombinant Human Interleukin-3, Sf9
k9 IL 3 cyt-722 Hystemcell.cn Recombinant Canine Interleukin-3
rmIL3 cyt-156 Hystemcell.cn Recombinant Rhesus Macaque Interleukin-3
IL 4 cyt-211 Hystemcell.cn Recombinant Human Interleukin-4
IL 4 CHO cyt-271 Hystemcell.cn Recombinant Human Interleukin-4 CHO
IL 4 His cyt-483 Hystemcell.cn Recombinant Human Interleukin-4, His Tag
IL 4 HEK cyt-097 Hystemcell.cn Recombinant Human Interleukin 4, HEK
mIL 4 cyt-282 Hystemcell.cn Recombinant Mouse Interleukin-4
rIL 4 cyt-385 Hystemcell.cn Recombinant Rat Interleukin-4
pIL 4 cyt-398 Hystemcell.cn Recombinant Porcine Interleukin-4
rmIL4 cyt-172 Hystemcell.cn Recombinant Rhesus Macaque Interleukin-4
IL 5 cyt-212 Hystemcell.cn Recombinant Human Interleukin-5
mIL 5 cyt-689 Hystemcell.cn Recombinant Mouse Interleukin-5
rIL 5 cyt-387 Hystemcell.cn Recombinant Rat Interleukin-5
IL 6 cyt-213 Hystemcell.cn Recombinant Human Interleukin-6
IL 6 CHO cyt-274 Hystemcell.cn Recombinant Human Interleukin-6, CHO
IL 6 His cyt-484 Hystemcell.cn Recombinant Human Interleukin-6, His Tag
IL 6 HEK cyt-098 Hystemcell.cn Recombinant Human Interleukin 6, HEK
mIL 6 cyt-350 Hystemcell.cn Recombinant Mouse Interleukin-6
rIL 6 cyt-388 Hystemcell.cn Recombinant Rat Interleukin-6
pIL 6 cyt-399 Hystemcell.cn Recombinant Porcine Interleukin-6
rmIL 6 cyt-174 Hystemcell.cn Recombinant Rhesus Macaque Interleukin-6
sIL 6R cyt-286 Hystemcell.cn Recombinant Human Soluble IL-6 Receptor alpha
IL 7 cyt-254 Hystemcell.cn Recombinant Human Interleukin-7
IL 7 Yeast cyt-298 Hystemcell.cn Recombinant Human Interleukin-7, Saccharomyces
IL 7 His cyt-485 Hystemcell.cn Recombinant Human Interleukin-7, His Tag
IL 7, HEK cyt-197 Hystemcell.cn Recombinant Human Interleukin-7, HEK
mIL 7 cyt-372 Hystemcell.cn Recombinant Mouse Interleukin-7
rIL 7 cyt-163 Hystemcell.cn Recombinant Rat Interleukin-7
IL 9 cyt-348 Hystemcell.cn Recombinant Human Interleukin-9
IL 9 HEK cyt-099 Hystemcell.cn Recombinant Human Interleukin 9, HEK
mIL 9 cyt-373 Hystemcell.cn Recombinant Mouse Interleukin-9
rIL 9 cyt-748 Hystemcell.cn Recombinant Rat Interleukin-9
IL 10 cyt-500 Hystemcell.cn Recombinant Human Interleukin-10
IL 10 His cyt-486 Hystemcell.cn Recombinant Human Interleukin-10, His Tag
IL 10 HEK cyt-100 Hystemcell.cn Recombinant Human Interleukin 10, HEK
mIL 10 cyt-497 Hystemcell.cn Recombinant Mouse Interleukin-10
rIL 10 cyt-465 Hystemcell.cn Recombinant Rat Interleukin-10
pIL 10 cyt-404 Hystemcell.cn Recombinant Porcine Interleukin-10
IL 11 cyt-214 Hystemcell.cn Recombinant Human Interleukin-11
IL 11 Pichia cyt-013 Hystemcell.cn Recombinant Human Interleukin-11, Pichia
mIL 11 cyt-646 Hystemcell.cn Recombinant Mouse Interleukin-11
IL 12 cyt-101 Hystemcell.cn Recombinant Human Interleukin 12
IL 12 p35 His cyt-487 Hystemcell.cn Recombinant Human Interleukin-12 p35, His Tag
IL 12 p40 Baculovirus cyt-134 Hystemcell.cn Recombinant Human Interleukin-12 p40, Baculovirus
IL 12 p40 His cyt-488 Hystemcell.cn Recombinant Human Interleukin-12 p40, His Tag
IL 12 p40 Plant cyt-056 Hystemcell.cn Recombinant Human Interleukin-12 p40, Plant
mIL 12 cyt-144 Hystemcell.cn Recombinant Mouse Interleukin-12
rIL 12 cyt-390 Hystemcell.cn Recombinant Rat Interleukin-12
IL 13 cyt-446 Hystemcell.cn Recombinant Human Interleukin-13
IL 13 Variant cyt-682 Hystemcell.cn Recombinant Human Interleukin-13 Variant
IL 13 His cyt-489 Hystemcell.cn Recombinant Human Interleukin-13, His Tag
mIL 13 cyt-375 Hystemcell.cn Recombinant Mouse Interleukin-13
rIL 13 cyt-391 Hystemcell.cn Recombinant Rat Interleukin-13
rIL 13 109 a.a. cyt-182 Hystemcell.cn Recombinant Rat Interleukin-13 109 a.a.
rmIL 13 cyt-175 Hystemcell.cn Recombinant Rhesus Macaque Interleukin-13
IL 15 cyt-230 Hystemcell.cn Recombinant Human Interleukin-15
IL 15 His cyt-490 Hystemcell.cn Recombinant Human Interleukin-15, His Tag
mIL 15 cyt-344 Hystemcell.cn Recombinant Mouse Interleukin-15
mIL 15 His cyt-647 Hystemcell.cn Recombinant Mouse Interleukin-15, His Tag
rIL 15 cyt-345 Hystemcell.cn Recombinant Rat Interleukin-15
pIL 15 cyt-403 Hystemcell.cn Recombinant Porcine Interleukin-15
IL 16, (130 a.a.) cyt-536 Hystemcell.cn Recombinant Human Interleukin-16, (130 a.a.)
IL 16, (121 a.a.) cyt-142 Hystemcell.cn Recombinant Human Interleukin-16, (121 a.a.)
IL 16 His cyt-562 Hystemcell.cn Recombinant Human Interleukin-16, His Tag
mIL 16 cyt-559 Hystemcell.cn Recombinant Mouse Interleukin-16
maIL 16 cyt-153 Hystemcell.cn Recombinant Rhesus Macaque Interleukin-16
IL 17A cyt-250 Hystemcell.cn Recombinant Human Interleukin-17A
IL 17A His cyt-662 Hystemcell.cn Recombinant Human Interleukin-17A His Tag
IL 17A HEK cyt-102 Hystemcell.cn Recombinant Human Interleukin 17A, HEK
IL 17E cyt-583 Hystemcell.cn Recombinant Human Interleukin-17E
IL 17F cyt-587 Hystemcell.cn Recombinant Human Interleukin-17F
IL 17F HEK cyt-103 Hystemcell.cn Recombinant Human Interleukin 17F, HEK
IL 17 A/F cyt-623 Hystemcell.cn Recombinant Human Interleukin-17 A/F Heterodimer
mIL 17 cyt-378 Hystemcell.cn Recombinant Mouse Interleukin-17A
mIL 17E cyt-641 Hystemcell.cn Recombinant Mouse Interleukin-17E
mIL 17F cyt-642 Hystemcell.cn Recombinant Mouse Interleukin-17F
mIL 17 A/F cyt-640 Hystemcell.cn Recombinant Mouse Interleukin-17 A/F Heterodimer
rIL 17 A/F cyt-677 Hystemcell.cn Recombinant Rat Interleukin-17 A/F Heterodimer
rIL 17 cyt-542 Hystemcell.cn Recombinant Rat Interleukin-17A
rIL 17E cyt-576 Hystemcell.cn Recombinant Rat Interleukin-17E
rIL 17F cyt-643 Hystemcell.cn Recombinant Rat Interleukin-17F
IL 18 cyt-269 Hystemcell.cn Recombinant Human Interleukin-18
IL 18 His cyt-663 Hystemcell.cn Recombinant Human Interleukin-18 His Tag
IL18BP cyt-728 Hystemcell.cn Recombinant Human Interleukin-18 Binding Protein
mIL 18 cyt-634 Hystemcell.cn Recombinant Mouse Interleukin-18
rIL 18 cyt-376 Hystemcell.cn Recombinant Rat Interleukin-18
IL 19 cyt-363 Hystemcell.cn Recombinant Human Interleukin-19
mIL 19 cyt-411 Hystemcell.cn Recombinant Mouse Interleukin-19
IL 20 cyt-347 Hystemcell.cn Recombinant Human Interleukin-20
mIL 20 cyt-379 Hystemcell.cn Recombinant Mouse Interleukin-20
IL 21 cyt-408 Hystemcell.cn Recombinant Human Interleukin-21
mIL 21 cyt-684 Hystemcell.cn Recombinant Mouse Interleukin-21
rIL 21 cyt-033 Hystemcell.cn Recombinant Rat Interleukin-21
IL 22 cyt-328 Hystemcell.cn Recombinant Human Interleukin-22
mIL 22 cyt-539 Hystemcell.cn Recombinant Mouse Interleukin-22
rIL 22 cyt-173 Hystemcell.cn Recombinant Rat Interleuikin-22
mIL 22 PEG cyt-701 Hystemcell.cn Recombinant Mouse Interleukin-22, Pegylated
mIL 22A cyt-148 Hystemcell.cn Recombinant Mouse Interleukin-22 Antagonist (E117A)
IL 23 cyt-050 Hystemcell.cn Recombinant Human Interleukin-23
IL 23 His cyt-067 Hystemcell.cn Recombinant Human Interleukin-23, His Tag
IL 24 cyt-515 Hystemcell.cn Recombinant Human Interleukin-24
IL 27 cyt-048 Hystemcell.cn Recombinant Human Interleukin-27 p28
mIL 27 cyt-570 Hystemcell.cn Recombinant Mouse Interleukin-27
IL 28A cyt-602 Hystemcell.cn Recombinant Human Interleukin-28A
IL 28A HEK cyt-104 Hystemcell.cn Recombinant Human Interleukin-28A, HEK
mIL 28A cyt-741 Hystemcell.cn Recombinant Mouse Interleukin-28A
IL 28B cyt-105 Hystemcell.cn Recombinant Human Interleukin-28B
mIL 28B cyt-732 Hystemcell.cn Recombinant Mouse Interleukin-28B
IL 29 cyt-603 Hystemcell.cn Recombinant Human Interleukin-29
IL 29 HEK cyt-117 Hystemcell.cn Recombinant Human Interleukin-29, HEK
IL 31 cyt-625 Hystemcell.cn Recombinant Human Interleukin-31
mIL 31 cyt-604 Hystemcell.cn Recombinant Mouse Interleukin-31
IL 32A cyt-584 Hystemcell.cn Recombinant Human IL-32 alpha
IL 32A His Tag cyt-648 Hystemcell.cn Recombinant Human IL-32 alpha His Tag
IL 33 cyt-425 Hystemcell.cn Recombinant Human Interleukin-33
IL 33 His cyt-667 Hystemcell.cn Recombinant Human Interleukin-33 His Tag
mIL 33 cyt-655 Hystemcell.cn Recombinant Mouse Interleukin-33
rIL 33 cyt-150 Hystemcell.cn Recombinant Rat Interleukin-33
IL34 cyt-042 Hystemcell.cn Recombinant Human Interleukin-34
IL36RN cyt-009 Hystemcell.cn Recombinant Human Interleukin-36 Receptor Antagonist
mIL36RN cyt-154 Hystemcell.cn Recombinant Mouse Interleukin-36 Receptor Antagonist
IL36A cyt-158 Hystemcell.cn Recombinant Human Interleukin-36 Alpha
IL36A 158 a.a. cyt-179 Hystemcell.cn Recombinant Human Interleukin-36 Alpha 158 a.a.
mIL36A cyt-162 Hystemcell.cn Recombinant Mouse Interleukin-36 Alpha
mIL36A 153 a.a. cyt-181 Hystemcell.cn Recombinant Mouse Interleukin-36 Alpha 153 a.a.
IL36B cyt-159 Hystemcell.cn Recombinant Human Interleukin-36 Beta
IL36B 153 a.a. cyt-180 Hystemcell.cn Recombinant Human Interleukin-36 Beta 153 a.a
mIL36B cyt-165 Hystemcell.cn Recombinant Mouse Interleukin-36 Beta
IL36G cyt-160 Hystemcell.cn Recombinant Human Interleukin-36 Gamma
IL36G 152 a.a. cyt-161 Hystemcell.cn Recombinant Human Interleukin-36 Gamma 152 a.a.
mIL36G cyt-745 Hystemcell.cn Recombinant Mouse Interleukin-36 Gamma
IL37 cyt-011 Hystemcell.cn Recombinant Human Interleukin 37
IL1F10 cyt-012 Hystemcell.cn Recombinant Human Interleukin 1 Family, Member 10
Insulin cyt-270 Hystemcell.cn Recombinant Human Insulin
Insulin Yeast cyt-614 Hystemcell.cn Recombinant Human Insulin Yeast
pInsulin cyt-468 Porcine Insulin
KGF cyt-219 Hystemcell.cn Recombinant Human Keratinocyte Growth Factor
mKGF cyt-721 Hystemcell.cn Recombinant Mouse Keratinocyte Growth Factor
KGF HEK cyt-086 Hystemcell.cn Recombinant Human Keratinocyte Growth Factor, HEK
KGF 2 cyt-303 Hystemcell.cn Recombinant Human Keratinocyte Growth Factor-2
KGF 2 His cyt-129 Hystemcell.cn Recombinant Human Keratinocyte Growth Factor-2, His Tag
mKGF 2 cyt-126 Hystemcell.cn Recombinant Mouse Keratinocyte Growth Factor-2
rKGF cyt-127 Hystemcell.cn Recombinant Rat Keratinocyte Growth Factor-2
Leptin cyt-228 Hystemcell.cn Recombinant Human Leptin
Leptin cyt-683 Human Leptin
Leptin His cyt-287 Hystemcell.cn Recombinant Human Leptin, His Tag
mLeptin cyt-351 Hystemcell.cn Recombinant Mouse Leptin
mLeptin PEG cyt-591 Hystemcell.cn Recombinant Pegylated Mouse Leptin
rLeptin cyt-227 Hystemcell.cn Recombinant Rat Leptin
rLeptin PEG cyt-592 Hystemcell.cn Recombinant Pegylated Rat Leptin
oLeptin cyt-239 Hystemcell.cn Recombinant Ovine Leptin
oLeptin, MTS cyt-531 Hystemcell.cn Recombinant Ovine Leptin, MTS tag
bLeptin cyt-502 Hystemcell.cn Recombinant Bovine Leptin
pLeptin cyt-503 Hystemcell.cn Recombinant Porcine Leptin
pfLeptin cyt-530 Hystemcell.cn Recombinant Pufferfish Leptin
sLeptin cyt-704 Hystemcell.cn Recombinant Salamander Leptin
hLeptin cyt-504 Hystemcell.cn Recombinant Horse Leptin
chLeptin cyt-505 Hystemcell.cn Recombinant Chicken Leptin
dLeptin cyt-506 Hystemcell.cn Recombinant Dog Leptin
raLeptin cyt-507 Hystemcell.cn Recombinant Rabbit Leptin
Leptin tA cyt-352 Hystemcell.cn Recombinant Human Leptin Triple Antagonist
Leptin tA PEG cyt-702 Hystemcell.cn Recombinant Human Leptin Triple Antagonist, Pegylated
Leptin qA cyt-353 Hystemcell.cn Recombinant Human Leptin Quadruple Antagonist
mLeptin tA cyt-354 Hystemcell.cn Recombinant Mouse Leptin Triple Antagonist
mLeptin tA PEG cyt-566 Hystemcell.cn Recombinant Pegylated Mouse Leptin Triple Antagonist, Pegylated
rLeptin tA cyt-355 Hystemcell.cn Recombinant Rat Leptin Triple Antagonist
rLeptin tA PEG cyt-567 Hystemcell.cn Recombinant Pegylated Rat Leptin Triple Antagonist, Pegylated
oLeptin tA cyt-356 Hystemcell.cn Recombinant Ovine Leptin Triple Antagonist
oLeptin tA PEG cyt-703 Hystemcell.cn Recombinant Ovine Leptin Triple Antagonist, Pegylated
oLeptin qA cyt-357 Hystemcell.cn Recombinant Ovine Leptin Quadruple Antagonist
Leptin Receptor cyt-508 Hystemcell.cn Recombinant Human Leptin Binding Domain
chLeptin Receptor cyt-509 Hystemcell.cn Recombinant Chicken Leptin Binding Domain
LFA 3 cyt-423 Hystemcell.cn Recombinant Human Leukocyte Function Associated Antigen-3 Fusion Protein
LIF cyt-644 Hystemcell.cn Recombinant Human Leukemia Inhibitory Factor
mLIF cyt-645 Hystemcell.cn Recombinant Mouse Leukemia Inhibitory Factor
LIF GST cyt-001 Hystemcell.cn Recombinant Human Leukemia Inhibitory Factor, GST tag
rLIF cyt-731 Hystemcell.cn Recombinant Rat Leukemia Inhibitory Factor
MANF, His cyt-133 Hystemcell.cn Recombinant Human Mesencephalic Astrocyte-Derived Neurotrophic Factor, His Tag
MANF cyt-141 Hystemcell.cn Recombinant Human Mesencephalic Astrocyte-Derived Neurotrophic Factor
M CSF cyt-308 Hystemcell.cn Recombinant Human Macrophage Colony Stimulating Factor
M CSF Baculovirus cyt-637 Hystemcell.cn Recombinant Human Macrophage Colony Stimulating Factor, Baculovirus
M CSF HEK cyt-106 Hystemcell.cn Recombinant Human Macrophage Colony Stimulating Factor, HEK
M CSF His cyt-695 Hystemcell.cn Recombinant Human Macrophage Colony Stimulating Factor, His Tag
mM CSF cyt-439 Hystemcell.cn Recombinant Mouse Macrophage Colony Stimulating Factor
rM CSF cyt-046 Hystemcell.cn Recombinant Rat Macrophage Colony Stimulating Factor
MIF cyt-575 Hystemcell.cn Recombinant Human Macrophage Migration Inhibitor Factor
MIF (Active) cyt-596 Hystemcell.cn Recombinant Human Macrophage Migration Inhibitor Factor
MIF His N cyt-431 Hystemcell.cn Recombinant Human Macrophage Migration Inhibitor Factor, His Tag N-Terminus
MIF His C cyt-521 Hystemcell.cn Recombinant Human Macrophage Migration Inhibitor Factor, His Tag C-Terminus
mMIF cyt-744 Hystemcell.cn Recombinant Mouse Macrophage Migration Inhibitor Factor
rMIF cyt-193 Hystemcell.cn Recombinant Rat Macrophage Migration Inhibitor Factor
MIA cyt-310 Hystemcell.cn Recombinant Human Melanoma Inhibitory Activity Protein
MIA2 cyt-638 Hystemcell.cn Recombinant Human Melanoma Inhibitory Activity Protein 2
Midkine cyt-192 Hystemcell.cn Recombinant Human Midkine
Midkine, His cyt-444 Hystemcell.cn Recombinant Human Midkine, His Tag
mMidkine cyt-178 Hystemcell.cn Recombinant Mouse Midkine
rMidkine cyt-747 Hystemcell.cn Recombinant Rat Midkine
MTPN cyt-723 Hystemcell.cn Recombinant Human Myotrophin
Myostatin cyt-418 Hystemcell.cn Recombinant Human Myostatin
Myostatin His cyt-445 Hystemcell.cn Recombinant Human Myostatin, His-Tag
Myostatin Propetide cyt-448 Hystemcell.cn Recombinant Human Myostatin Propeptide
Myostatin Plant cyt-055 Hystemcell.cn Recombinant Human Myostatin, Plant
NGB cyt-450 Hystemcell.cn Recombinant Human Neuroglobin
NRG1 cyt-407 Hystemcell.cn Recombinant Human Neuregulin-1/Heregulin-b2
NRG1 B1 cyt-733 Hystemcell.cn Recombinant Human Neuregulin-1/Heregulin-b1
NRG1 A cyt-736 Hystemcell.cn Recombinant Human Neuregulin-1/Heregulin Alpha (EGF Domain)
NT 3 cyt-257 Hystemcell.cn Recombinant Human Neurotrophin-3
proNT3 cyt-015 Hystemcell.cn Recombinant Human Precursor Neurotrophin-3
mNT 3 cyt-688 Hystemcell.cn Recombinant Mouse Neurotrophin-3
NT 4 cyt-626 Hystemcell.cn Recombinant Human Neurotrophin-4
Noggin cyt-475 Hystemcell.cn Recombinant Human Noggin
Noggin HEK cyt-107 Hystemcell.cn Recombinant Human Noggin, HEK
mNoggin cyt-600 Hystemcell.cn Recombinant Mouse Noggin
Omentin cyt-301 Hystemcell.cn Recombinant Human Omentin
Omentin His cyt-551 Hystemcell.cn Recombinant Human Omentin His Tag
Omentin 298 a.a. cyt-061 Hystemcell.cn Recombinant Human Omentin 298 a.a.
OPG Fc cyt-266 Hystemcell.cn Recombinant Human Osteoprotegerin/Fc Chimera
OPG cyt-177 Hystemcell.cn Recombinant Human Osteoprotegerin
OPG His cyt-290 Hystemcell.cn Recombinant Human Osteoprotegerin, His Tag
OPG Hi-5 cyt-633 Hystemcell.cn Recombinant Human Osteoprotegerin Hi-5
OSM cyt-231 Hystemcell.cn Recombinant Human Oncostatin-M
OSM (209 a.a.) cyt-639 Hystemcell.cn Recombinant Human Oncostatin-M (209 a.a.)
OSM (195 a.a.) cyt-735 Hystemcell.cn Recombinant Human Oncostatin-M (195 a.a.)
OSM, His cyt-060 Hystemcell.cn Recombinant Human Oncostatin-M, His Tag
OSM HEK cyt-108 Hystemcell.cn Recombinant Human Oncostatin-M, HEK
mOSM cyt-168 Hystemcell.cn Recombinant Mouse Oncostatin-M
rOSM cyt-169 Hystemcell.cn Recombinant Rat Oncostatin-M
OSTF1 cyt-630 Hystemcell.cn Recombinant Human Osteoclast Stimulating Factor-1
OTOR cyt-582 Hystemcell.cn Recombinant Human Otoraplin
PDGF AA cyt-341 Hystemcell.cn Recombinant Human Plaet Derived Growth Factor-AA
PDGF AA Yeast cyt-568 Hystemcell.cn Recombinant Human Plaet Derived Growth Factor-AA, Yeast
PDGF AA HEK cyt-109 Hystemcell.cn Recombinant Human Plaet Derived Growth Factor-AA HEK
PDGF A cyt-491 Hystemcell.cn Recombinant Human Plaet Derived Growth Factor-A
mPDGF AA cyt-590 Hystemcell.cn Recombinant Mouse Plaet Derived Growth Factor-AA
PDGF AB cyt-342 Hystemcell.cn Recombinant Human Plaet Derived Growth Factor-AB
PDGF BB cyt-501 Hystemcell.cn Recombinant Human Plaet Derived Growth Factor-BB
PDGF B cyt-492 Hystemcell.cn Recombinant Human Plaet Derived Growth Factor-B
mPDGF BB cyt-412 Hystemcell.cn Recombinant Mouse Plaet Derived Growth Factor-BB
rPDGF BB cyt-740 Hystemcell.cn Recombinant Rat Plaet Derived Growth Factor-BB
PDGFD cyt-155 Hystemcell.cn Recombinant Human Plaet Derived Growth Factor-D
PDGFRA cyt-065 Hystemcell.cn Recombinant Human Plaet-Derived Growth Factor Receptor, Alpha
PEDF cyt-580 Hystemcell.cn Recombinant Human Pigment Epithelium-Derived Factor
PEDF His cyt-552 Hystemcell.cn Recombinant Human Pigment Epithelium-Derived Factor, His Tag
PEDF HEK cyt-553 Hystemcell.cn Recombinant Human Pigment Epithelium-Derived Factor, HEK
Periostin cyt-452 Hystemcell.cn Recombinant Human Periostin
PGRN cyt-524 Hystemcell.cn Recombinant Human Progranulin
Pleiotrophin cyt-451 Hystemcell.cn Recombinant Human Pleiotrophin
Pleiotrophin HEK cyt-198 Hystemcell.cn Recombinant Human Pleiotrophin, HEK
Placental Lactogen cyt-656 Hystemcell.cn Recombinant Human Placental Lactogen
bPlacental Lactogen cyt-511 Hystemcell.cn Recombinant Bovine Placental Lactogen
oPlacental Lactogen cyt-512 Hystemcell.cn Recombinant Ovine Placental Lactogen
cPlacental Lactogen cyt-510 Hystemcell.cn Recombinant Caprine Placental Lactogen
PLGF 1 cyt-419 Hystemcell.cn Recombinant Human Placenta Growth Factor-1
PLGF 2 cyt-420 Hystemcell.cn Recombinant Human Placenta Growth Factor-2
Prolactin cyt-267 Hystemcell.cn Recombinant Human Prolactin
Prolactin His cyt-493 Hystemcell.cn Recombinant Human Prolactin, His Tag
mProlactin cyt-321 Hystemcell.cn Recombinant Mouse Prolactin
rProlactin cyt-322 Hystemcell.cn Recombinant Rat Prolactin
oProlactin cyt-240 Hystemcell.cn Recombinant Ovine Prolactin
raProlactin cyt-513 Hystemcell.cn Recombinant Rabbit Prolactin
Prl R, GST cyt-469 Hystemcell.cn Recombinant Human Prolactin Receptor , GST Tag
Prl R cyt-595 Hystemcell.cn Recombinant Human Prolactin Receptor
raPrl R cyt-268 Hystemcell.cn Recombinant Rabbit Prolactin Soluble Receptor
oPrl R cyt-293 Hystemcell.cn Recombinant Ovine Prolactin Soluble Receptor
bPrl R cyt-294 Hystemcell.cn Recombinant Bovine Prolactin Soluble Receptor
tPrl R cyt-532 Hystemcell.cn Recombinant Raibow Trout Prolactin Soluble Receptor
rPrl R cyt-533 Hystemcell.cn Recombinant Rat Prolactin Soluble Receptor
oPrl A cyt-311 Hystemcell.cn Recombinant Ovine Prolactin Antagonist
oPrl A Mutant cyt-705 Hystemcell.cn Recombinant Ovine Prolactin Antagonist, Mutant
sCD4 cyt-304 Hystemcell.cn Recombinant Human Soluble CD4
CD4 (26-226) cyt-313 Hystemcell.cn Recombinant Human CD4 (26-226)
CD4 (125-202) cyt-315 Hystemcell.cn Recombinant Human CD4 (125-202)
CD4 (203-317) cyt-316 Hystemcell.cn Recombinant Human CD4 (203-317)
sCD40L cyt-245 Hystemcell.cn Recombinant Human soluble CD40 Ligand/TRAP
sCD40L His cyt-670 Hystemcell.cn Recombinant Human soluble CD40 Ligand/TRAP His Tag
msCD40L cyt-472 Hystemcell.cn Recombinant Mouse soluble CD40 Ligand/TRAP
SCGB1A1 cyt-743 Hystemcell.cn Recombinant Human Uteroglobin
mSCGB1A1 cyt-746 Hystemcell.cn Recombinant Mouse Uteroglobin
SHH cyt-676 Hystemcell.cn Recombinant Human Sonic HedgeHog
SHH, His cyt-717 Hystemcell.cn Recombinant Human Sonic HedgeHog, His Tag
mSHH cyt-597 Hystemcell.cn Recombinant Mouse Sonic HedgeHog
mSHH, His cyt-711 Hystemcell.cn Recombinant Mouse Sonic HedgeHog, His Tag
DHH cyt-467 Hystemcell.cn Recombinant Human Desert HedgeHog
DHH (C23II) cyt-362 Hystemcell.cn Recombinant Human Desert HedgeHog (C23II)
sRANKL cyt-334 Hystemcell.cn Recombinant Human Soluble RANK Ligand
sRANKL His cyt-692 Hystemcell.cn Recombinant Human Soluble RANK Ligand, His Tag
sRANKL GST cyt-631 Hystemcell.cn Recombinant Human Soluble RANK Ligand, GST Tag
msRANKL cyt-320 Hystemcell.cn Recombinant Mouse Soluble RANK Ligand
sRANK Receptor cyt-734 Hystemcell.cn Recombinant Human Soluble RANK Receptor
mRELM a cyt-309 Hystemcell.cn Recombinant Mouse RELM-alpha
mRELM a His cyt-453 Hystemcell.cn Recombinant Mouse RELM-alpha His Tag
RELM b cyt-454 Hystemcell.cn Recombinant Human RELM-beta
mRELM b cyt-413 Hystemcell.cn Recombinant Mouse RELM-beta
mRELM g cyt-455 Hystemcell.cn Recombinant Mouse RELM-Gamma
Resistin cyt-456 Hystemcell.cn Recombinant Human Resistin
Resistin His cyt-256 Hystemcell.cn Recombinant Human Resistin, His Tag
Resistin Mutant cyt-585 Hystemcell.cn Recombinant Human Resistin Mutant
mResistin cyt-457 Hystemcell.cn Recombinant Mouse Resistin
rResistin cyt-458 Hystemcell.cn Recombinant Rat Resistin
RBP1 cyt-122 Hystemcell.cn Recombinant Human Retinol Binding Protein-1
RBP4 cyt-535 Hystemcell.cn Recombinant Human Retinol Binding Protein-4
RBP4 His cyt-555 Hystemcell.cn Recombinant Human Retinol Binding Protein-4 His Tag
RBP5 cyt-650 Hystemcell.cn Recombinant Human Retinol Binding Protein-5
RBP7 cyt-023 Hystemcell.cn Recombinant Human Retinol Binding Protein-7
SAA1 cyt-675 Hystemcell.cn Recombinant Human Serum Amyloid A (APO-SAA1)
rmSAA1 cyt-719 Hystemcell.cn Recombinant Rhesus Macaque Serum Amyloid A (APO-SAA1)
SAA4 cyt-002 Hystemcell.cn Recombinant Human Serum Amyloid A4
SCF cyt-255 Hystemcell.cn Recombinant Human Stem Cell Factor
mSCF cyt-275 Hystemcell.cn Recombinant Mouse Stem Cell Factor
rSCF cyt-323 Hystemcell.cn Recombinant Rat Stem Cell Factor
SCF Sf9 cyt-421 Hystemcell.cn Recombinant Human Stem Cell Factor, Sf9
SCF HEK cyt-111 Hystemcell.cn Recombinant Human Stem Cell Factor, HEK
k9SCF cyt-194 Hystemcell.cn Recombinant Canine Stem Cell Factor
SF20 cyt-622 Hystemcell.cn Recombinant Human Chromosome 19 Open Reading Frame 10
mSF20 cyt-678 Hystemcell.cn Recombinant Mouse Chromosome 19 Open Reading Frame 10
SPP1 cyt-635 Hystemcell.cn Recombinant Human Osteopontin
SPP1 HEK cyt-047 Hystemcell.cn Recombinant Human Osteopontin, HEK
TACI cyt-032 Hystemcell.cn Recombinant Human Tumor Necrosis Factor Receptor 13B
TAFA2 cyt-118 Hystemcell.cn Recombinant Human Family with Sequence Similarity 19 Member A2
TDGF1 cyt-712 Hystemcell.cn Recombinant Human Teratocarcinoma-Derived Growth Factor 1
TFF1 cyt-586 Hystemcell.cn Recombinant Human Trefoil Factor-1
TFF1 His cyt-610 Hystemcell.cn Recombinant Human Trefoil Factor-1 His Tag
TFF2 cyt-612 Hystemcell.cn Recombinant Human Trefoil Factor-2
TFF2 His cyt-611 Hystemcell.cn Recombinant Human Trefoil Factor-2 His Tag
TFF3 cyt-005 Hystemcell.cn Recombinant Human Trefoil Factor-3
TFF3 His cyt-616 Hystemcell.cn Recombinant Human Trefoil Factor-3 His Tag
TGF b 1 cyt-716 Hystemcell.cn Recombinant Human Transforming Growth Factor-Beta 1
TGF b 1 cyt-561 Human Transforming Growth Factor-Beta 1
TGF b 1 GST cyt-473 Hystemcell.cn Recombinant Human Transforming Growth Factor-Beta 1, GST tag
TGF b 1 His cyt-672 Hystemcell.cn Recombinant Human Transforming Growth Factor-Beta 1 His Tag
TGF b 1 (113 a.a.) cyt-679 Hystemcell.cn Recombinant Human Transforming Growth Factor-Beta 1 (113 a.a.)
TGF b 2 cyt-441 Hystemcell.cn Recombinant Human Transforming Growth Factor-Beta 2
TGF b 2 HEK cyt-112 Hystemcell.cn Recombinant Human Transforming Growth Factor-Beta 2, HEK
TGF b 3 cyt-368 Hystemcell.cn Recombinant Human Transforming Growth Factor-Beta 3
TGF b 3 CHO cyt-685 Hystemcell.cn Recombinant Human Transforming Growth Factor-Beta 3, CHO
TGF b 3 Plant cyt-588 Hystemcell.cn Recombinant Human Transforming Growth Factor-Beta 3, Plant
TGF b 3 HEK cyt-113 Hystemcell.cn Recombinant Human Transforming Growth Factor-Beta 3, HEK
TGF b 3 (207 a.a.) cyt-319 Hystemcell.cn Recombinant Human Transforming Growth Factor-Beta 3 (644-850)
mTGF b 3 cyt-143 Hystemcell.cn Recombinant Mouse Transforming Growth Factor-Beta 3
4 1BBR cyt-463 Hystemcell.cn Recombinant Human 4-1BB Receptor
4 1BBR, His cyt-137 Hystemcell.cn Recombinant Human 4-1BB Receptor His Tag
4 1BBL cyt-149 Hystemcell.cn Recombinant Human 4-1BB Ligand
4 1BBL, His cyt-649 Hystemcell.cn Recombinant Human 4-1BB Ligand, His Tag
TNF a cyt-223 Hystemcell.cn Recombinant Human Tumor Necrosis Factor-alpha
TNF a His cyt-494 Hystemcell.cn Recombinant Human Tumor Necrosis Factor-alpha, His Tag
TNF a HEK cyt-114 Hystemcell.cn Recombinant Human Tumor Necrosis Factor-alpha, HEK
mTNF a cyt-252 Hystemcell.cn Recombinant Mouse Tumor Necrosis Factor-alpha
rTNF a cyt-393 Hystemcell.cn Recombinant Rat Tumor Necrosis Factor-alpha
rpTNF a cyt-405 Hystemcell.cn Recombinant Porcine Tumor Necrosis Factor-alpha
raTNF a cyt-008 Hystemcell.cn Recombinant Rabbit Tumor Necrosis Factor-alpha
rCaTNF a cyt-140 Hystemcell.cn Recombinant Canine Tumor Necrosis Factor-alpha
rmTNF a cyt-737 Hystemcell.cn Recombinant Rhesus Macaque Tumor Necrosis Factor-alpha
TNF a Mutant cyt-384 Hystemcell.cn Recombinant Human Tumor Necrosis Factor-alpha, Mutant
TNF b cyt-224 Hystemcell.cn Recombinant Human Tumor Necrosis Factor-beta
TNF b His cyt-495 Hystemcell.cn Recombinant Human Tumor Necrosis Factor-beta, His Tag
TNFR2 cyt-674 Hystemcell.cn Recombinant Human Tumor Necrosis Factor Receptor Type 2
TNFR2 Fc cyt-422 Hystemcell.cn Recombinant Human Tumor Necrosis Factor Receptor 2 Fusion Protein
TNFRSF17 cyt-598 Hystemcell.cn Recombinant Human B-Cell Maturation Antigen
TNFRSF17, His cyt-190 Hystemcell.cn Recombinant Human B-Cell Maturation Antigen, His Tag
TNFR cyt-707 Hystemcell.cn Recombinant Human Tumor Necrosis Factor Receptor
TNFR His cyt-673 Hystemcell.cn Recombinant Human Tumor Necrosis Factor Receptor Type His Tag
TNFSF12 cyt-699 Hystemcell.cn Recombinant Human TNF Ligand Superfamily Member 12
TNFRSF10B cyt-069 Hystemcell.cn Recombinant Human TNF Ligand Receptor Superfamily Member 10B
TNFRSF12A cyt-043 Hystemcell.cn Recombinant Human TNF Ligand Receptor Superfamily Member 12A
TSLP cyt-572 Hystemcell.cn Recombinant Human Thymic Stromal Lymphopoietin
TSLPR cyt-742 Hystemcell.cn Recombinant Human Thymic Stromal Lymphopoietin Receptor
TPO cyt-302 Hystemcell.cn Recombinant Human Thrombopoietin
TPO CHO cyt-462 Hystemcell.cn Recombinant Human Thrombopoietin, CHO
TPO HEK cyt-115 Hystemcell.cn Recombinant Human Thrombopoietin, HEK
mTPO cyt-346 Hystemcell.cn Recombinant Mouse Thrombopoietin
TRAIL cyt-443 Hystemcell.cn Recombinant Human TNF-Related Apoptosis Inducing Ligand/Apo2L
TRAIL (114-281 a.a.) cyt-546 Hystemcell.cn Recombinant Human TNF-Related Apoptosis Inducing Ligand/Apo2L (114-281)
ULBP1 cyt-166 Hystemcell.cn Recombinant Human UL16 Binding Protein 1
Vaspin cyt-459 Hystemcell.cn Recombinant Human Vaspin
VEGF cyt-241 Hystemcell.cn Recombinant Human Vascular Endothelial Growth Factor
VEGF His cyt-496 Hystemcell.cn Recombinant Human Vascular Endothelial Growth Factor, His Tag
VEGF CHO cyt-260 Hystemcell.cn Recombinant Human Vascular Endothelial Growth Factor, CHO
VEGF HEK cyt-225 Hystemcell.cn Recombinant Human Vascular Endothelial Growth Factor, HEK
VEGF Yeast cyt-577 Hystemcell.cn Recombinant Human Vascular Endothelial Growth Factor, Yeast
VEGF (121a.a.) cyt-343 Hystemcell.cn Recombinant Human Vascular Endothelial Growth Factor (121)
VEGF (121a.a.) Sf9 cyt-200 Hystemcell.cn Recombinant Human Vascular Endothelial Growth Factor (121), Sf9
VEGF (121a.a.) His cyt-619 Hystemcell.cn Recombinant Human Vascular Endothelial Growth Factor (121), His Tag
VEGF (121a.a.) HEK cyt-116 Hystemcell.cn Recombinant Human Vascular Endothelial Growth Factor (121), HEK
rmVEGF cyt-336 Hystemcell.cn Recombinant Mouse Vascular Endothelial Growth Factor
mVEGF Sf9 cyt-226 Hystemcell.cn Recombinant Mouse Vascular Endothelial Growth Factor-Sf9
rmVEGF (121a.a.) cyt-574 Hystemcell.cn Recombinant Mouse Vascular Endothelial Growth Factor (121)
rmVEGF His cyt-680 Hystemcell.cn Recombinant Mouse Vascular Endothelial Growth Factor, His Tag
rVEGF cyt-392 Hystemcell.cn Recombinant Rat Vascular Endothelial Growth Factor
VEGFB cyt-628 Hystemcell.cn Recombinant Human Vascular Endothelial Growth Factor B
VEGF C cyt-527 Hystemcell.cn Recombinant Human Vascular Endothelial Growth Factor Related Protein
rVEGF C cyt-262 Hystemcell.cn Recombinant Rat Vascular Endothelial Growth Factor Related Protein
rVEGF C (152a.a.) cyt-284 Hystemcell.cn Recombinant Rat Vascular Endothelial Growth Factor-C (152)
VEGF D cyt-045 Hystemcell.cn Recombinant Human Vascular Endothelial Growth Factor D
VEGF E (Orf Virus) cyt-263 Hystemcell.cn Recombinant Vascular Endothelial Growth Factor-E (Orf Virus)
VEGI cyt-517 Hystemcell.cn Recombinant Human Vascular Endothelial Growth Inhibitor
VEGI His cyt-589 Hystemcell.cn Recombinant Human Vascular Endothelial Growth Inhibitor, His Tag
Visfatin cyt-318 Hystemcell.cn Recombinant Human Visfatin
Visfatin His cyt-563 Hystemcell.cn Recombinant Human Visfatin, His Tag
mVisfatin cyt-447 Hystemcell.cn Recombinant Mouse Visfatin
重慶市華雅干細胞技術有限公司 :
2025 版權所有 © 重慶市華雅干細胞技術有限公司 備案號:渝ICP備14000349號-4 sitemap.xml 管理登陸 技術支持:化工儀器網
地址:重慶市江北區金渝大道153號8棟20-14 傳真:023-63419626 郵件:[email protected]
重慶市華雅干細胞技術有限公司主要經營干細胞研究 干細胞治療產品 生物試劑 實驗耗材 藥物研發等產品。

關注我們
